TB-500
Also known as: Thymosin Beta-4, Tβ4
Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.
| Quantity | Discount | Per vial |
|---|---|---|
| 1–2 | — | $65.00 |
| 3+ | −5% | $61.75 |
| 5+ | −10% | $58.50 |
| 10+ | −15% | $55.25 |
- COA issued by Janoshik Analytical
- HPLC + MS verified identity
- Ships discreetly from Canada
- Interac & crypto accepted
Specifications
| CAS number | 77591-33-4 |
|---|---|
| Molecular formula | C212H350N56O78S |
| Molecular weight | 4963.4 g/mol |
| Sequence / structure | Ac-LKKTETQ (active Thymosin beta-4 region; full Tβ4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) |
| Purity | ≥99% (HPLC) |
| Appearance | White lyophilized powder |
| Solubility | Soluble in bacteriostatic water / 0.9% NaCl |
| Storage | Lyophilized: -20°C, 24+ months. Reconstituted: 2-8°C, use within 4 weeks. |
| Available sizes | 10mg |
Reference data compiled from public chemical databases and the peer-reviewed literature. Provided for laboratory research use only.
Research context
Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.
Thymosin Beta-4. A 43-amino-acid research compound involved in actin sequestration and tissue repair.
For research use only. Not for human or veterinary use. Sold as a laboratory reference material for in-vitro research.
Certificate of Analysis
Each lot of TB-500 is independently tested by Janoshik Analytical by HPLC (purity) and mass spectrometry (identity), and released against a batch-specific certificate of analysis. Request the COA for your lot number and we'll send the matching certificate so you can verify vial-to-lot before any assay work.
Request this batch's COA →New to COAs? Read our guide on how to read a peptide certificate of analysis.
Frequently asked questions
What is TB-500 studied for?
Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.
What is the molecular formula of TB-500?
TB-500 has molecular formula C212H350N56O78S, and a molecular weight of ~4963.4 g/mol, and CAS number 77591-33-4.
How is TB-500 stored and reconstituted?
Soluble in bacteriostatic water / 0.9% NaCl Lyophilized: -20°C, 24+ months. Reconstituted: 2-8°C, use within 4 weeks.
Is TB-500 for human use?
No. TB-500 is supplied strictly as a laboratory reference material for research use only — not for human or veterinary use.
Researcher reviews
No researcher reviews yet for TB-500. Verified reviews from researchers appear here after a completed order.